Mmp21 Peptide - middle region
Mmp21 Peptide - middle region
Product Specifications
UniProt
Q08EI4
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with MMP21 Rabbit Polyclonal Antibody (orb586229) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: YIPQEPAFELDWADRKAIQRLYGSCKGSFDTVFDWIRKERNQY GEVRVR
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC942946-500 1x 500 µL
TLE1 (Synovial Sarcoma Marker) (TLE1/2946R), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
![Ubiquitin Recombinant Rabbit Monoclonal Antibody [ST46-03]](https://cdn.genprice.uk/products/992/68dd1c90061270361ea82a7d/imageurl/et1609-21.webp)
ET1609-21 100 µL
Ubiquitin Recombinant Rabbit Monoclonal Antibody [ST46-03]
Sign In for Pricing
View Details 
![FITC Anti-Human CD49d Antibody[BU49]](https://cdn.genprice.uk/products/763/68dd14b2061270361e7d4366/imageurl/e-ab-f1040c.webp)