SEC24C Peptide - N-terminal region
SEC24C Peptide - N-terminal region
Product Specifications
UniProt
B4DZT4
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SEC24C Rabbit Polyclonal Antibody (orb586240) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: AVDFFGAFYMSNTTDVELAGLDGDKTVTVEFKHDDRLNEESGALLQCALL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC681482-100 1x 100 µL
S100A4 (Marker of Tumor Metastasis) (S100A4/1482), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
TRC-H825650-5MG 5 mg
1-(4-(4-Hydroxyphenyl)butan-2-yl)-1H-indole-5,6-diol
Sign In for Pricing
View Details