SEC24C Peptide - N-terminal region
SEC24C Peptide - N-terminal region
Product Specifications
UniProt
B4DZT4
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SEC24C Rabbit Polyclonal Antibody (orb586240) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: AVDFFGAFYMSNTTDVELAGLDGDKTVTVEFKHDDRLNEESGALLQCALL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
H-2001-1 1 mg
HRP Conjugated Ricinus communis Lectin (Castor Bean) -RCA-I-
Sign In for Pricing
View Details ![PADI4 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5E7]](https://cdn.genprice.uk/products/937/6868c367994c49e6dc3f5d19/imageurl/ta504814am.webp)
TA504814AM 100 µL
PADI4 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5E7]
Sign In for Pricing
View Details 