Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC7A10 Peptide - C-terminal region

SLC7A10 Peptide - C-terminal region

Product Specifications

UniProt

K7EK51

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SLC7A10 Rabbit Polyclonal Antibody (orb326536) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KCVHRLTESMTHWGQELCFVVYPQDAPEEEENGPCPPSLLPATDKPSKPQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LOC728392 Human Gene Knockout Kit (CRISPR)
KN428058 1 Kit

LOC728392 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MAVS Recombinant Rabbit monoclonal Antibody
HA750741 100 µL

MAVS Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal Antibody
TA396917S 25 µL

Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Hydroxy Ebastine
TRC-H918700-5MG 5 mg

Hydroxy Ebastine

Sign In for Pricing
View Details
Human RASL12 activation kit by CRISPRa
GA109705 1 Kit

Human RASL12 activation kit by CRISPRa

Sign In for Pricing
View Details
Benzoyl Cyanide
TRC-B130375-5G 5 g

Benzoyl Cyanide

Sign In for Pricing
View Details