SLC7A10 Peptide - C-terminal region
SLC7A10 Peptide - C-terminal region
Product Specifications
UniProt
K7EK51
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SLC7A10 Rabbit Polyclonal Antibody (orb326536) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: KCVHRLTESMTHWGQELCFVVYPQDAPEEEENGPCPPSLLPATDKPSKPQ
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GA117580 1 Kit
Human Transglutaminase 6 (TGM6) activation kit by CRISPRa
Sign In for Pricing
View Details 
ICH1124-5mg 5 mg
Anti-Mouse IFN Beta (MIB-5E9.1) In Vivo Antibody - Low Endotoxin
Sign In for Pricing
View Details ![RPL13 Recombinant Rabbit Monoclonal Antibody [JE62-34]](https://cdn.genprice.uk/products/992/68dd1c90061270361ea829ae/imageurl/ha720097.webp)
HA720097 100 µL
RPL13 Recombinant Rabbit Monoclonal Antibody [JE62-34]
Sign In for Pricing
View Details 
