Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SNX27 Peptide - C-terminal region

SNX27 Peptide - C-terminal region

Product Specifications

UniProt

Q96L92

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SNX27 Rabbit Polyclonal Antibody (orb586243) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EEILLNDNDLAVTYFFHQAVDDVKKGYIKAEEKSYQLQKLYEQRKMVMYL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human POLA2 activation kit by CRISPRa
GA108461 1 Kit

Human POLA2 activation kit by CRISPRa

Sign In for Pricing
View Details
Edoxaban (1R,2R,4R) isomer
TRC-C381210-100MG 100 mg

Edoxaban (1R,2R,4R) isomer

Sign In for Pricing
View Details
MAGEA10 Polyclonal Antibody
E-AB-15184-01 20 µL

MAGEA10 Polyclonal Antibody

Sign In for Pricing
View Details
MAGEA10 Polyclonal Antibody
E-AB-15184-02 60 µL

MAGEA10 Polyclonal Antibody

Sign In for Pricing
View Details
MAGEA10 Polyclonal Antibody
E-AB-15184-03 120 µL

MAGEA10 Polyclonal Antibody

Sign In for Pricing
View Details
MAGEA10 Polyclonal Antibody
E-AB-15184-04 200 µL

MAGEA10 Polyclonal Antibody

Sign In for Pricing
View Details