Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LYPD3 Peptide - C-terminal region

LYPD3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

C4.4A

UniProt

O95274

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LYPD3 Rabbit Polyclonal Antibody (orb586319) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055215

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PVRPTSTTKPMPAPTSQTPRQGVEHEASRDEEPRLTGGAAGHQDRSNSGQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Saccharomyces cerevisiae Elp3 Antibody (Biotine Conjugate)
DZ41382-Biotin 200 µL/Vial

Anti-Saccharomyces cerevisiae Elp3 Antibody (Biotine Conjugate)

Sign In for Pricing
View Details
SLC16A8 Antibody, HRP conjugated
MBS7052398-01 0.05 mg

SLC16A8 Antibody, HRP conjugated

Sign In for Pricing
View Details
SLC16A8 Antibody, HRP conjugated
MBS7052398-02 0.1 mg

SLC16A8 Antibody, HRP conjugated

Sign In for Pricing
View Details
SLC16A8 Antibody, HRP conjugated
MBS7052398-03 5x 0.1 mg

SLC16A8 Antibody, HRP conjugated

Sign In for Pricing
View Details
HTRA2 Rabbit pAb
E2514877 100 µL

HTRA2 Rabbit pAb

Sign In for Pricing
View Details
Mouse Kell Ectodomain MAb (Clone 214711)
MAB1454-SP 25 µg

Mouse Kell Ectodomain MAb (Clone 214711)

Sign In for Pricing
View Details