Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LYPD3 Peptide - C-terminal region

LYPD3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

C4.4A

UniProt

O95274

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LYPD3 Rabbit Polyclonal Antibody (orb586319) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055215

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PVRPTSTTKPMPAPTSQTPRQGVEHEASRDEEPRLTGGAAGHQDRSNSGQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IGFBP7 Peptide (AAP48174)
AAP48174-100UG 100 µg

IGFBP7 Peptide (AAP48174)

Sign In for Pricing
View Details
PABP1 Polyclonal Antibody
E11-202806 100 µg -100 µL

PABP1 Polyclonal Antibody

Sign In for Pricing
View Details
DOA-3 Panel Test Card, Cassette Device
07RD7093 1 Each

DOA-3 Panel Test Card, Cassette Device

Sign In for Pricing
View Details
Olfr845 sgRNA CRISPR Lentivector (Mouse) (Target 1)
K4244402 1.0 µg DNA

Olfr845 sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
C21orf33 (Chromosome 21 Open Reading Frame 33, HES1, KNPI, ES1 Protein Homolog, Mitochondrial, Protein GT335, Protein KNP-I) (MaxLight 490)
124121-ML490 100 µL

C21orf33 (Chromosome 21 Open Reading Frame 33, HES1, KNPI, ES1 Protein Homolog, Mitochondrial, Protein GT335, Protein KNP-I) (MaxLight 490)

Sign In for Pricing
View Details
LOC100132167 Protein Vector (Human) (pPB-N-His)
PV023938 500 ng

LOC100132167 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details