PADI6 Peptide - N-terminal region
PADI6 Peptide - N-terminal region
Product Specifications
UniProt
Q6TGC4
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PADI6 Rabbit Polyclonal Antibody (orb586369) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_997304
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: GAILLVNCNPADVGQQLEDKKTKKVIFSEEITNLSQMTLNVQGPSCILKK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![CD90 / THY1 Recombinant Rabbit Monoclonal Antibody [SU35-07]](https://cdn.genprice.uk/products/992/68dd1c90061270361ea829da/imageurl/et1608-46.webp)
ET1608-46 100 µL
CD90 / THY1 Recombinant Rabbit Monoclonal Antibody [SU35-07]
Sign In for Pricing
View Details 
PKSH032240-01 10 µg
Recombinant Human Cerberus/CER1 Protein (His Tag)
Sign In for Pricing
View Details PKSH032240-02 50 µg
Recombinant Human Cerberus/CER1 Protein (His Tag)
Sign In for Pricing
View Details 
