PADI6 Peptide - N-terminal region
PADI6 Peptide - N-terminal region
Product Specifications
UniProt
Q6TGC4
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PADI6 Rabbit Polyclonal Antibody (orb586369) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_997304
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: GAILLVNCNPADVGQQLEDKKTKKVIFSEEITNLSQMTLNVQGPSCILKK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TRC-D445118-2.5G 2.5 g
6,7-Dichloro-1,4-dihydro-4-oxo-3-quinolinecarboxylic Acid Ethyl Ester
Sign In for Pricing
View Details 
![(2S,3S,5S)-5-[(N-Formyl-L-leucyl)oxy]-2-hexyl-3-hydroxyhexadecanoic Acid (Orlistat Impurity) (>80%)](https://cdn.genprice.uk/products/572/5418388474138/imageurl/trc-f700600-1mg.webp)
TRC-F700600-1MG 1 mg
(2S,3S,5S)-5-[(N-Formyl-L-leucyl)oxy]-2-hexyl-3-hydroxyhexadecanoic Acid (Orlistat Impurity) (>80%)
Sign In for Pricing
View Details 