Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HTR3E Peptide - C-terminal region

HTR3E Peptide - C-terminal region

Product Specifications

UniProt

E9PGF1

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HTR3E Rabbit Polyclonal Antibody (orb326565) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GPAEAELTGGSEWTRAQREHEAQKQHSVELWLQFSHAMDAMLFRLYLLFM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nucleophosmin (Acute Myeloid Leukemia Marker) (NPM1/1902), CF488A conjugate, 0.1mg/mL
BNC881902-100 1x 100 µL

Nucleophosmin (Acute Myeloid Leukemia Marker) (NPM1/1902), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human LZM (Lysozyme) ELISA Kit
E-EL-H1869-01 24 Tests

Human LZM (Lysozyme) ELISA Kit

Sign In for Pricing
View Details
Human LZM (Lysozyme) ELISA Kit
E-EL-H1869-02 48 Tests

Human LZM (Lysozyme) ELISA Kit

Sign In for Pricing
View Details
Human LZM (Lysozyme) ELISA Kit
E-EL-H1869-03 96 Tests

Human LZM (Lysozyme) ELISA Kit

Sign In for Pricing
View Details
NRP2 Human Gene Knockout Kit (CRISPR)
KN210928BN 1 Kit

NRP2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
RAB23 Mouse Monoclonal Antibody [Clone ID: OTI1A3]
CF809382 100 µg

RAB23 Mouse Monoclonal Antibody [Clone ID: OTI1A3]

Sign In for Pricing
View Details