PIK3C2A Peptide - C-terminal region
PIK3C2A Peptide - C-terminal region
Product Specifications
UniProt
F5H2B0
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PIK3C2A Rabbit Polyclonal Antibody (orb331330) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: PNPYVKTYLLPDNHKTSKRKTKISRKTRNPTFNEMLVYSGYSKETLRQRE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC041429-100 1x 100 µL
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740204-500 1x 500 µL
Complement C4d (C4D204), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040181-500 1x 500 µL
CD59 (heavy chain of Protectin) (BRA-10G), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400008-100 1x 100 µL
MAGE A1 (MA454), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 