CNOT9 Peptide - middle region
CNOT9 Peptide - middle region
Product Specifications
Product Name Alternative
RCD1, CAF40, CT129, RCD-1, RQCD1
UniProt
Q92600
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CNOT9 Rabbit Polyclonal Antibody (orb586451) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_005435
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SLGVIGALVKTDEQEVINFLLTTEIIPLCLRIMESGSELSKTVATFILQK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS145522-01 0.002 mg
Recombinant Human Receptor Activity-Modifying Protein 3
Sign In for Pricing
View Details MBS145522-02 0.01 mg
Recombinant Human Receptor Activity-Modifying Protein 3
Sign In for Pricing
View Details MBS145522-03 0.1 mg
Recombinant Human Receptor Activity-Modifying Protein 3
Sign In for Pricing
View Details MBS145522-04 5x 0.1 mg
Recombinant Human Receptor Activity-Modifying Protein 3
Sign In for Pricing
View Details 