Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CNOT9 Peptide - middle region

CNOT9 Peptide - middle region

Product Specifications

Product Name Alternative

RCD1, CAF40, CT129, RCD-1, RQCD1

UniProt

Q92600

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CNOT9 Rabbit Polyclonal Antibody (orb586451) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005435

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SLGVIGALVKTDEQEVINFLLTTEIIPLCLRIMESGSELSKTVATFILQK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DNAJB6 Rabbit Polyclonal Antibody (Cy3)
orb2702249 100 µg

DNAJB6 Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details
Annexin A1 Antibody
F49712-0.08ML 0.08 mL

Annexin A1 Antibody

Sign In for Pricing
View Details
APC/Cy7 Linked Polyclonal Antibody to Procollagen III N-Terminal Propeptide (PIIINP)
MBS2107458-01 0.1 mL

APC/Cy7 Linked Polyclonal Antibody to Procollagen III N-Terminal Propeptide (PIIINP)

Sign In for Pricing
View Details
APC/Cy7 Linked Polyclonal Antibody to Procollagen III N-Terminal Propeptide (PIIINP)
MBS2107458-02 0.2 mL

APC/Cy7 Linked Polyclonal Antibody to Procollagen III N-Terminal Propeptide (PIIINP)

Sign In for Pricing
View Details
APC/Cy7 Linked Polyclonal Antibody to Procollagen III N-Terminal Propeptide (PIIINP)
MBS2107458-03 0.5 mL

APC/Cy7 Linked Polyclonal Antibody to Procollagen III N-Terminal Propeptide (PIIINP)

Sign In for Pricing
View Details
APC/Cy7 Linked Polyclonal Antibody to Procollagen III N-Terminal Propeptide (PIIINP)
MBS2107458-04 1 mL

APC/Cy7 Linked Polyclonal Antibody to Procollagen III N-Terminal Propeptide (PIIINP)

Sign In for Pricing
View Details