Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RRAGB Peptide - C-terminal region

RRAGB Peptide - C-terminal region

Product Specifications

UniProt

Q5VZM2

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RRAGB Rabbit Polyclonal Antibody (orb586452) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IDIFTSNTYVMVVMSDPSIPSAATLINIRNARKHFEKLERVDGPKQCLLM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human TIP120A (CAND1) activation kit by CRISPRa
GA111005 1 Kit

Human TIP120A (CAND1) activation kit by CRISPRa

Sign In for Pricing
View Details
BRMS1 (NM_001024957) Human Over-expression Lysate
LC422568 20 µg

BRMS1 (NM_001024957) Human Over-expression Lysate

Sign In for Pricing
View Details
MED13L Antibody
8C16573-AAT 50 µg

MED13L Antibody

Sign In for Pricing
View Details
Human CCDC50 activation kit by CRISPRa
GA115824 1 Kit

Human CCDC50 activation kit by CRISPRa

Sign In for Pricing
View Details
4-Fluorophenyl-5’-oxobutyric Acid
TRC-F588495-1G 1 g

4-Fluorophenyl-5’-oxobutyric Acid

Sign In for Pricing
View Details
ANKZF1 (NM_001042410) Human Over-expression Lysate
LY420885 100 µg

ANKZF1 (NM_001042410) Human Over-expression Lysate

Sign In for Pricing
View Details