Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPAG16 Peptide - N-terminal region

SPAG16 Peptide - N-terminal region

Product Specifications

Product Name Alternative

PF20, WDR29

UniProt

Q4G1A2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SPAG16 Rabbit Polyclonal Antibody (orb331341) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_078808

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LENENKNLKKDLKHYKQAADKAREDLLKIQKERDFHRMHHKRIVQEKNKL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human SSMEM1 shRNA Plasmid
abx965182-01 150 µg

Human SSMEM1 shRNA Plasmid

Sign In for Pricing
View Details
Human SSMEM1 shRNA Plasmid
abx965182-02 300 µg

Human SSMEM1 shRNA Plasmid

Sign In for Pricing
View Details
InVivo MAb Anti-Human/Mouse TREM2 Antibody (Fs0313)
VHJ69203-01 100 µg

InVivo MAb Anti-Human/Mouse TREM2 Antibody (Fs0313)

Sign In for Pricing
View Details
InVivo MAb Anti-Human/Mouse TREM2 Antibody (Fs0313)
VHJ69203-02 1 mg

InVivo MAb Anti-Human/Mouse TREM2 Antibody (Fs0313)

Sign In for Pricing
View Details
EF-1 γ (C-7) Alexa Fluor® 488
sc-393378 AF488 200 µg/mL

EF-1 γ (C-7) Alexa Fluor® 488

Sign In for Pricing
View Details
Human Transmembrane Protease, Serine 2 (TMPRSS2) ELISA Kit
MBS160543-01 48 Well

Human Transmembrane Protease, Serine 2 (TMPRSS2) ELISA Kit

Sign In for Pricing
View Details