Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPAG16 Peptide - N-terminal region

SPAG16 Peptide - N-terminal region

Product Specifications

Product Name Alternative

PF20, WDR29

UniProt

Q4G1A2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SPAG16 Rabbit Polyclonal Antibody (orb331341) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_078808

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LENENKNLKKDLKHYKQAADKAREDLLKIQKERDFHRMHHKRIVQEKNKL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Endometrium
CS501238 5x 5 µm

Frozen Tissue Sections, Endometrium

Sign In for Pricing
View Details
Recombinant Chicken Glutathione S Transferase Mu 1 (GSTM1)
RPU41671-01 50 µg

Recombinant Chicken Glutathione S Transferase Mu 1 (GSTM1)

Sign In for Pricing
View Details
Recombinant Chicken Glutathione S Transferase Mu 1 (GSTM1)
RPU41671-02 100 µg

Recombinant Chicken Glutathione S Transferase Mu 1 (GSTM1)

Sign In for Pricing
View Details
Recombinant Chicken Glutathione S Transferase Mu 1 (GSTM1)
RPU41671-03 1 mg

Recombinant Chicken Glutathione S Transferase Mu 1 (GSTM1)

Sign In for Pricing
View Details
Ara h 9.0201 Protein (Arachis hypogaea)
P522214 100 µg

Ara h 9.0201 Protein (Arachis hypogaea)

Sign In for Pricing
View Details
Psmc4 Mouse qPCR Primer Pair (NM_011874)
MP211859 200 Reactions

Psmc4 Mouse qPCR Primer Pair (NM_011874)

Sign In for Pricing
View Details