Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KRT8 Peptide - middle region

KRT8 Peptide - middle region

Product Specifications

UniProt

P05787

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KRT8 Rabbit Polyclonal Antibody (orb586490) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GLVEDFKNKYEDEINKRTEMENEFVLIKKDVDEAYMNKVELES RLEGLT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NCAPH2 siRNA (Human)
MBS8205122-01 15 nmol

NCAPH2 siRNA (Human)

Sign In for Pricing
View Details
NCAPH2 siRNA (Human)
MBS8205122-02 30 nmol

NCAPH2 siRNA (Human)

Sign In for Pricing
View Details
NCAPH2 siRNA (Human)
MBS8205122-03 5x 30 nmol

NCAPH2 siRNA (Human)

Sign In for Pricing
View Details
Human ETS transloCation variant 5, ETV5 ELISA Kit
MBS9332041-01 48 Well

Human ETS transloCation variant 5, ETV5 ELISA Kit

Sign In for Pricing
View Details
Human ETS transloCation variant 5, ETV5 ELISA Kit
MBS9332041-02 96 Well

Human ETS transloCation variant 5, ETV5 ELISA Kit

Sign In for Pricing
View Details
Human ETS transloCation variant 5, ETV5 ELISA Kit
MBS9332041-03 5x 96 Well

Human ETS transloCation variant 5, ETV5 ELISA Kit

Sign In for Pricing
View Details