Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RCBTB2 Peptide - N-terminal region

RCBTB2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

RLG, CHC1L

UniProt

O95199

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RCBTB2 Rabbit Polyclonal Antibody (orb586513) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001259.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ADGELFAWGYNNCGQVGSGSTANQPTPRKVTNCLHTKRVVNIACGQTSSM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Slc26a6 sgRNA CRISPR Lentivector (Mouse) (Target 3)
K5007904 1.0 µg DNA

Slc26a6 sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
SMYD3 Human Over-expression Lysate
orb1376763 20 µg

SMYD3 Human Over-expression Lysate

Sign In for Pricing
View Details
Myozenin 1 CRISPR Activation Plasmid (m2)
sc-425557-ACT-2 20 µg

Myozenin 1 CRISPR Activation Plasmid (m2)

Sign In for Pricing
View Details
PGAP2, CT (PGAP2, FRAG1, Post-GPI attachment to proteins factor 2, FGF receptor-activating protein 1) (MaxLight 405)
MBS6332974-01 0.1 mL

PGAP2, CT (PGAP2, FRAG1, Post-GPI attachment to proteins factor 2, FGF receptor-activating protein 1) (MaxLight 405)

Sign In for Pricing
View Details
PGAP2, CT (PGAP2, FRAG1, Post-GPI attachment to proteins factor 2, FGF receptor-activating protein 1) (MaxLight 405)
MBS6332974-02 5x 0.1 mL

PGAP2, CT (PGAP2, FRAG1, Post-GPI attachment to proteins factor 2, FGF receptor-activating protein 1) (MaxLight 405)

Sign In for Pricing
View Details
Phospho-EphA2(S897) Antibody Blocking peptide
MBS9225238-01 0.5 mg

Phospho-EphA2(S897) Antibody Blocking peptide

Sign In for Pricing
View Details