Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SNTG2 Peptide - C-terminal region

SNTG2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

G2SYN, SYN5

UniProt

Q9NY99

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SNTG2 Rabbit Polyclonal Antibody (orb331345) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_061841

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NVLWRFKFSQLKGSSDDGKTRVKLLFQNLDTKQIETKELEFQDLRAVLHC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Crhr1 ELISA KIT
ELI-03848m 96 Tests

Mouse Crhr1 ELISA KIT

Sign In for Pricing
View Details
Bovine GATS-like protein 3, GATSL3 ELISA Kit
MBS9322425-01 48 Well

Bovine GATS-like protein 3, GATSL3 ELISA Kit

Sign In for Pricing
View Details
Bovine GATS-like protein 3, GATSL3 ELISA Kit
MBS9322425-02 96 Well

Bovine GATS-like protein 3, GATSL3 ELISA Kit

Sign In for Pricing
View Details
Bovine GATS-like protein 3, GATSL3 ELISA Kit
MBS9322425-03 5x 96 Well

Bovine GATS-like protein 3, GATSL3 ELISA Kit

Sign In for Pricing
View Details
Bovine GATS-like protein 3, GATSL3 ELISA Kit
MBS9322425-04 10x 96 Well

Bovine GATS-like protein 3, GATSL3 ELISA Kit

Sign In for Pricing
View Details
AMPIGENE® Bst Polymerase with Dye
ENZ-NUC139-1600 1600 U

AMPIGENE® Bst Polymerase with Dye

Sign In for Pricing
View Details