Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SNX33 Peptide - C-terminal region

SNX33 Peptide - C-terminal region

Product Specifications

Product Name Alternative

SH3PX3, SH3PXD3C, SNX30

UniProt

Q8WV41

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SNX33 Rabbit Polyclonal Antibody (orb331346) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_695003

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FPDIIHLQKGAFAKVKESQRMSDEGRMVQDEADGIRRRCRVVGFALQAEM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Monoclonal ICOS Antibody (AP-MAB0857) [HRP]
NBP1-06686H 0.1 mL

Rat Monoclonal ICOS Antibody (AP-MAB0857) [HRP]

Sign In for Pricing
View Details
Lentiviral mouse Lpp shRNA (UAS) - Lentiviral mouse Lpp shRNA (UAS, RFP) plasmid
GTR15258229 1 Vial

Lentiviral mouse Lpp shRNA (UAS) - Lentiviral mouse Lpp shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
Mmu-miR-1298-5p miRNA Mimic
orb1875489-01 5 nmol

Mmu-miR-1298-5p miRNA Mimic

Sign In for Pricing
View Details
Mmu-miR-1298-5p miRNA Mimic
orb1875489-02 10 nmol

Mmu-miR-1298-5p miRNA Mimic

Sign In for Pricing
View Details
Recombinant Lactobacillus fermentum Molybdenum cofactor biosynthesis protein A (moaA)
MBS1051434-01 0.02 mg (E-Coli)

Recombinant Lactobacillus fermentum Molybdenum cofactor biosynthesis protein A (moaA)

Sign In for Pricing
View Details
Recombinant Lactobacillus fermentum Molybdenum cofactor biosynthesis protein A (moaA)
MBS1051434-02 0.02 mg (Yeast)

Recombinant Lactobacillus fermentum Molybdenum cofactor biosynthesis protein A (moaA)

Sign In for Pricing
View Details