Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SNX33 Peptide - C-terminal region

SNX33 Peptide - C-terminal region

Product Specifications

Product Name Alternative

SH3PX3, SH3PXD3C, SNX30

UniProt

Q8WV41

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SNX33 Rabbit Polyclonal Antibody (orb331346) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_695003

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FPDIIHLQKGAFAKVKESQRMSDEGRMVQDEADGIRRRCRVVGFALQAEM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PPM1K (NM_152542) Human Tagged Lenti ORF Clone
RC207144L1 10 µg

PPM1K (NM_152542) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Recombinant Human FAH
P1861-01 50 µg

Recombinant Human FAH

Sign In for Pricing
View Details
Recombinant Human FAH
P1861-02 200 µg

Recombinant Human FAH

Sign In for Pricing
View Details
Recombinant Human FAH
P1861-03 1 mg

Recombinant Human FAH

Sign In for Pricing
View Details
5-Acetamido-2,4,6-triiodoisophthaloyl Dichloride
MBS6076817-01 5 mg

5-Acetamido-2,4,6-triiodoisophthaloyl Dichloride

Sign In for Pricing
View Details
5-Acetamido-2,4,6-triiodoisophthaloyl Dichloride
MBS6076817-02 5x 5 mg

5-Acetamido-2,4,6-triiodoisophthaloyl Dichloride

Sign In for Pricing
View Details