Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Spaca3 Peptide - C-terminal region

Spaca3 Peptide - C-terminal region

Product Specifications

UniProt

Q9D9X8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Spaca3 Rabbit Polyclonal Antibody (orb586519) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RIYCTDLLNNDL KDSIVCAMKIVQEPLGLGYWEAWRHHCQGRDLSDWVD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD147 (BSG) (NM_198589) Human Recombinant Protein
TP720365 10 µg

CD147 (BSG) (NM_198589) Human Recombinant Protein

Sign In for Pricing
View Details
Mouse Parp2 activation kit by CRISPRa
GA200097 1 Kit

Mouse Parp2 activation kit by CRISPRa

Sign In for Pricing
View Details
Alpha-Bungarotoxin CF®488A 100ug
#00005-100ug 1x 100 µg

Alpha-Bungarotoxin CF®488A 100ug

Sign In for Pricing
View Details
HLADQA1 (HLA-DQA1) (Center) Rabbit Polyclonal Antibody
AP52053PU-N 400 µL

HLADQA1 (HLA-DQA1) (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PTP1B Mouse Monoclonal Antibody [D0-C7]
M1511-7 100 µL

PTP1B Mouse Monoclonal Antibody [D0-C7]

Sign In for Pricing
View Details
Cacng1 Mouse Gene Knockout Kit (CRISPR)
KN502431 1 Kit

Cacng1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details