Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Spaca3 Peptide - C-terminal region

Spaca3 Peptide - C-terminal region

Product Specifications

UniProt

Q9D9X8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Spaca3 Rabbit Polyclonal Antibody (orb586519) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RIYCTDLLNNDL KDSIVCAMKIVQEPLGLGYWEAWRHHCQGRDLSDWVD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

6-Chloropurine-9-b-D-ribofuranoside
TRC-C379900-500G 500 g

6-Chloropurine-9-b-D-ribofuranoside

Sign In for Pricing
View Details
Recombinant S100B Monoclonal Antibody
AN300068P 100 µL

Recombinant S100B Monoclonal Antibody

Sign In for Pricing
View Details
MBP, AlpHcAbs® Rabbit antibody (HRP)
HA710085 100 µg

MBP, AlpHcAbs® Rabbit antibody (HRP)

Sign In for Pricing
View Details
ATF2 pThr73/55 Rabbit Polyclonal Antibody
AP02333PU-S 50 µL

ATF2 pThr73/55 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
17a-Hydroxy Estra-5(10),9(11)-dien-3-one-d3
TRC-H897592-5MG 5 mg

17a-Hydroxy Estra-5(10),9(11)-dien-3-one-d3

Sign In for Pricing
View Details
Bulk Anti-Human CD62L (DREG56) Antibody
ICH1017-100mg 100 mg

Bulk Anti-Human CD62L (DREG56) Antibody

Sign In for Pricing
View Details