Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CEP120 Peptide - N-terminal region

CEP120 Peptide - N-terminal region

Product Specifications

UniProt

Q8N960

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CEP120 Rabbit Polyclonal Antibody (orb586535) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QHRLQRTPIKLQCFALDPVTSAKETIGYIVLDLRTAQETKQAPKWYQLLS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UBE3A (NM_000462) Human Over-expression Lysate
LY400164 100 µg

UBE3A (NM_000462) Human Over-expression Lysate

Sign In for Pricing
View Details
CD10 (Membrane Metalloendopeptidase) (MME/1870), Biotin conjugate, 0.1mg/mL
BNCB1870-100 1x 100 µL

CD10 (Membrane Metalloendopeptidase) (MME/1870), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ku70 (XRCC6) (NM_001469) Human Over-expression Lysate
LY400567 100 µg

Ku70 (XRCC6) (NM_001469) Human Over-expression Lysate

Sign In for Pricing
View Details
Abhd8 Mouse Gene Knockout Kit (CRISPR)
KN500664 1 Kit

Abhd8 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Terpineol (>90%)
TRC-T116625-25G 25 g

Terpineol (>90%)

Sign In for Pricing
View Details
Anti-Wilms Tumor Protein Antibody [SC06-41]
ET1610-45TR 20 µL

Anti-Wilms Tumor Protein Antibody [SC06-41]

Sign In for Pricing
View Details