Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CEP120 Peptide - N-terminal region

CEP120 Peptide - N-terminal region

Product Specifications

UniProt

Q8N960

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CEP120 Rabbit Polyclonal Antibody (orb586535) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QHRLQRTPIKLQCFALDPVTSAKETIGYIVLDLRTAQETKQAPKWYQLLS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(S)-Olodaterol Hydrochloride
TRC-O181530-5MG 5 mg

(S)-Olodaterol Hydrochloride

Sign In for Pricing
View Details
CCN6 Rabbit Polyclonal Antibody
TA367807 100 µL

CCN6 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Sall1 Mouse Gene Knockout Kit (CRISPR)
KN515265 1 Kit

Sall1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
5-Amino-1,3-diphenyl-1H-pyrazole
TRC-A618645-5G 5 g

5-Amino-1,3-diphenyl-1H-pyrazole

Sign In for Pricing
View Details
2-Aminobenzothiazole
TRC-A593500-10G 10 g

2-Aminobenzothiazole

Sign In for Pricing
View Details
ZNHIT2 (NM_014205) Human Recombinant Protein
TP308584L 1 mg

ZNHIT2 (NM_014205) Human Recombinant Protein

Sign In for Pricing
View Details