Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CNOT6L Peptide - middle region

CNOT6L Peptide - middle region

Product Specifications

UniProt

Q96LI5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CNOT6L Rabbit Polyclonal Antibody (orb326596) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AKIMSEQERKHVDGCAIFFKTEKFTLVQKHTVEFNQVAMANSDGSEAMLN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Colloidal Gold Conjugated Pisum sativum Lectin (Garden Pea) -PEA, PSA-,  10nm
GP-2701-10 1 mL

Colloidal Gold Conjugated Pisum sativum Lectin (Garden Pea) -PEA, PSA-, 10nm

Sign In for Pricing
View Details
6-Chloro-7-deazapurine-Alpha-D-riboside
TRC-C365181-25MG 25 mg

6-Chloro-7-deazapurine-Alpha-D-riboside

Sign In for Pricing
View Details
Fluo -4 AM Ultrapure (>98% purity) - Green fluorescent calcium indicator
1043C 500 µg

Fluo -4 AM Ultrapure (>98% purity) - Green fluorescent calcium indicator

Sign In for Pricing
View Details
HSV-1&2 TaqMan PCR Kit
TM31750 100 Reactions

HSV-1&2 TaqMan PCR Kit

Sign In for Pricing
View Details
Tissue Total RNA, Uterus
CR560185 5 µg

Tissue Total RNA, Uterus

Sign In for Pricing
View Details
N-(2-Chlorobenzyl)-2-(2-thienyl)ethylamine Hydrochloride
TRC-C375190-1G 1 g

N-(2-Chlorobenzyl)-2-(2-thienyl)ethylamine Hydrochloride

Sign In for Pricing
View Details