Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

COX7A2 Peptide - middle region

COX7A2 Peptide - middle region

Product Specifications

Product Name Alternative

COX7AL, COX7AL1, COXVIIAL, COXVIIa-L, VIIAL

UniProt

H0UI06

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with COX7A2 Rabbit Polyclonal Antibody (orb586537) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001856

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ASRRHFKNKVPEKQKLFQEDDEIPLYLKGGVADALLYRATMILTVGGTAY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Drosophila melanogaster (Fruit fly) INX5 Polyclonal Antibody
MBS9015209 Inquire

Rabbit anti-Drosophila melanogaster (Fruit fly) INX5 Polyclonal Antibody

Sign In for Pricing
View Details
GSTA3 (Glutathione S-transferase A3, GST Class-alpha Member 3, Glutathione S-transferase A3-3, MGC22232)
140478 200 µL

GSTA3 (Glutathione S-transferase A3, GST Class-alpha Member 3, Glutathione S-transferase A3-3, MGC22232)

Sign In for Pricing
View Details
Recombinant Human Regulator of G-protein signaling 16 (RGS16)
orb2658526-01 20 µg

Recombinant Human Regulator of G-protein signaling 16 (RGS16)

Sign In for Pricing
View Details
Recombinant Human Regulator of G-protein signaling 16 (RGS16)
orb2658526-02 100 µg

Recombinant Human Regulator of G-protein signaling 16 (RGS16)

Sign In for Pricing
View Details
Recombinant Human Regulator of G-protein signaling 16 (RGS16)
orb2658526-03 1 mg

Recombinant Human Regulator of G-protein signaling 16 (RGS16)

Sign In for Pricing
View Details
Rheostat, Sliding Contact, Open Type, Single Tube
1090960/6D 1 Each

Rheostat, Sliding Contact, Open Type, Single Tube

Sign In for Pricing
View Details