Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

COX7A2 Peptide - middle region

COX7A2 Peptide - middle region

Product Specifications

Product Name Alternative

COX7AL, COX7AL1, COXVIIAL, COXVIIa-L, VIIAL

UniProt

H0UI06

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with COX7A2 Rabbit Polyclonal Antibody (orb586537) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001856

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ASRRHFKNKVPEKQKLFQEDDEIPLYLKGGVADALLYRATMILTVGGTAY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

I3300-LT-Out-1Y Training Services
321427 1 Pack (1 Piece (s) x 1 Piece)

I3300-LT-Out-1Y Training Services

Sign In for Pricing
View Details
Mouse Monoclonal GDF-9 Antibody (GDF9/4261) [PerCP]
NBP3-08362PCP 0.1 mL

Mouse Monoclonal GDF-9 Antibody (GDF9/4261) [PerCP]

Sign In for Pricing
View Details
PFKM Rabbit Polyclonal Antibody
orb1939849 100 µg

PFKM Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
(11Beta)-21-Omicron-Betaenzoyl-16,17-dihydro-17-deoxy Cortisol
TRC-B208115-5MG 5 mg

(11Beta)-21-Omicron-Betaenzoyl-16,17-dihydro-17-deoxy Cortisol

Sign In for Pricing
View Details
CaMKKα (F-2) : m-IgG2a BP-HRP Bundle
sc-547074 1 Kit

CaMKKα (F-2) : m-IgG2a BP-HRP Bundle

Sign In for Pricing
View Details
Nori® Camel Fetuin A ELISA Kit
GR242129 96 Well

Nori® Camel Fetuin A ELISA Kit

Sign In for Pricing
View Details