Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

D2HGDH Peptide - N-terminal region

D2HGDH Peptide - N-terminal region

Product Specifications

UniProt

F6XUM0

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with D2HGDH Rabbit Polyclonal Antibody (orb586540) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AFERIVPGGVVTDPEALQAPNVDWLRTLRGCSKVLLRPRTSEEVSHILRH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PSPC1 Polyclonal Antibody
E-AB-18827-01 20 µL

PSPC1 Polyclonal Antibody

Sign In for Pricing
View Details
PSPC1 Polyclonal Antibody
E-AB-18827-02 60 µL

PSPC1 Polyclonal Antibody

Sign In for Pricing
View Details
PSPC1 Polyclonal Antibody
E-AB-18827-03 120 µL

PSPC1 Polyclonal Antibody

Sign In for Pricing
View Details
PSPC1 Polyclonal Antibody
E-AB-18827-04 200 µL

PSPC1 Polyclonal Antibody

Sign In for Pricing
View Details
NALP4 (NLRP4) (NM_134444) Human Recombinant Protein
TP307991 20 µg

NALP4 (NLRP4) (NM_134444) Human Recombinant Protein

Sign In for Pricing
View Details
2-Bromobenzyl Bromide
TRC-B679975-50G 50 g

2-Bromobenzyl Bromide

Sign In for Pricing
View Details