Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

D2HGDH Peptide - N-terminal region

D2HGDH Peptide - N-terminal region

Product Specifications

UniProt

F6XUM0

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with D2HGDH Rabbit Polyclonal Antibody (orb586540) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AFERIVPGGVVTDPEALQAPNVDWLRTLRGCSKVLLRPRTSEEVSHILRH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD2AP Antibody
OC-044-01 50 μL

CD2AP Antibody

Sign In for Pricing
View Details
CD2AP Antibody
OC-044-02 100 µL

CD2AP Antibody

Sign In for Pricing
View Details
CD2AP Antibody
OC-044-03 1 mL

CD2AP Antibody

Sign In for Pricing
View Details
OLR1 Antibody
KC-2966-01 50 μL

OLR1 Antibody

Sign In for Pricing
View Details
OLR1 Antibody
KC-2966-02 100 µL

OLR1 Antibody

Sign In for Pricing
View Details
OLR1 Antibody
KC-2966-03 1 mL

OLR1 Antibody

Sign In for Pricing
View Details