Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PAPLN Peptide - C-terminal region

PAPLN Peptide - C-terminal region

Product Specifications

UniProt

O95428

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PAPLN Rabbit Polyclonal Antibody (orb586563) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YQGSQAVSRSTEVKVVSPAPTAQPRDPGRDCVDQPELANCDLILQAQLCG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MEX3A (FITC)
568589-01 50 µg

MEX3A (FITC)

Sign In for Pricing
View Details
MEX3A (FITC)
568589-02 100 µg

MEX3A (FITC)

Sign In for Pricing
View Details
BOLL (Bol, Boule-like (Drosophila) ) (APC)
243850-APC 100 µL

BOLL (Bol, Boule-like (Drosophila) ) (APC)

Sign In for Pricing
View Details
Rabbit Polyclonal Anti-GABRB1 Antibody
TA350008 100 µL

Rabbit Polyclonal Anti-GABRB1 Antibody

Sign In for Pricing
View Details
Human TNFRSF1A Pre-designed siRNA Set B
SI017086B 1 Each

Human TNFRSF1A Pre-designed siRNA Set B

Sign In for Pricing
View Details
IL-17C Polyclonal Conjugated Antibody
MBS9454750-01 0.1 mL (Biotin)

IL-17C Polyclonal Conjugated Antibody

Sign In for Pricing
View Details