SEC31B Peptide - middle region
SEC31B Peptide - middle region
Product Specifications
Product Name Alternative
SEC31B-1, SEC31L2
UniProt
Q9NQW1
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SEC31B Rabbit Polyclonal Antibody (orb586574) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_056305
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: VGLGESPQPKGNDLNSDRQQAFCSQASKHTTKEASASSAFFDELVPQNMT
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1036926-01 0.05 mg (E-Coli)
Recombinant Clitoria ternatea Cyclotide cter-E
Sign In for Pricing
View Details