Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MCCC1 Peptide - N-terminal region

MCCC1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MCCA, MCC-B

UniProt

Q68D27

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MCCC1 Rabbit Polyclonal Antibody (orb326619) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001280202.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IKAVRGGGGKGMRIVRSEQEFQEQLESARREAKKSFNDDAMLIEKFVDTP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PQBP1 (NM_001032382) Human Recombinant Protein
TP323994M 100 µg

PQBP1 (NM_001032382) Human Recombinant Protein

Sign In for Pricing
View Details
2-anilinobutanoic acid
TRC-B411833-1G 1 g

2-anilinobutanoic acid

Sign In for Pricing
View Details
(1R,5R,6R)-rel-5-(1-Ethylpropoxy)-7-oxabicyclo[4.1.0]hept-3-ene-3-carboxylic Acid Ethyl Ester
TRC-E925695-25MG 25 mg

(1R,5R,6R)-rel-5-(1-Ethylpropoxy)-7-oxabicyclo[4.1.0]hept-3-ene-3-carboxylic Acid Ethyl Ester

Sign In for Pricing
View Details
Ergovaline
TRC-E600050-1MG 1 mg

Ergovaline

Sign In for Pricing
View Details
(Z)-5-(2,3-Bis(tert-butoxycarbonyl)guanidino)-2-((tert-butoxycarbonyl)amino)pentanoic Acid
TRC-B399828-25MG 25 mg

(Z)-5-(2,3-Bis(tert-butoxycarbonyl)guanidino)-2-((tert-butoxycarbonyl)amino)pentanoic Acid

Sign In for Pricing
View Details
ICA1 (NM_001136020) Human Over-expression Lysate
LY427769 100 µg

ICA1 (NM_001136020) Human Over-expression Lysate

Sign In for Pricing
View Details