Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MCCC1 Peptide - N-terminal region

MCCC1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MCCA, MCC-B

UniProt

Q68D27

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MCCC1 Rabbit Polyclonal Antibody (orb326619) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001280202.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IKAVRGGGGKGMRIVRSEQEFQEQLESARREAKKSFNDDAMLIEKFVDTP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Spectrin beta III (SPTBN2) (SPTBN2/1778), Biotin conjugate, 0.1mg/mL
BNCB1778-500 1x 500 µL

Spectrin beta III (SPTBN2) (SPTBN2/1778), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
2,3,4-Trichloronitrobenzene
TRC-T774430-25G 25 g

2,3,4-Trichloronitrobenzene

Sign In for Pricing
View Details
HMG14 (HMGN1) (NM_004965) Human Recombinant Protein
TP310454 20 µg

HMG14 (HMGN1) (NM_004965) Human Recombinant Protein

Sign In for Pricing
View Details
RASSF7 (NM_003475) Human Recombinant Protein
TP312844M 100 µg

RASSF7 (NM_003475) Human Recombinant Protein

Sign In for Pricing
View Details
Human MDFIC2 activation kit by CRISPRa
GA119888 1 Kit

Human MDFIC2 activation kit by CRISPRa

Sign In for Pricing
View Details
Mouse IgG2b (Fcγ Fragment specific), AlpSdAbs® VHH
HA710253 100 µg

Mouse IgG2b (Fcγ Fragment specific), AlpSdAbs® VHH

Sign In for Pricing
View Details