Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BTBD7 Peptide - N-terminal region

BTBD7 Peptide - N-terminal region

Product Specifications

UniProt

G3V3T2

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BTBD7 Rabbit Polyclonal Antibody (orb586663) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SPRVGGNSQAQQTFIGTSSYSQQGYGCESKLYSLDHGHEKPQDKKKRTSG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anserini AT-1 ELISA Kit
EAA0228 96 Tests

Anserini AT-1 ELISA Kit

Sign In for Pricing
View Details
ZNF329 Mouse Monoclonal Antibody [Clone ID: OTI5E5]
TA809557 100 µL

ZNF329 Mouse Monoclonal Antibody [Clone ID: OTI5E5]

Sign In for Pricing
View Details
Complement factor 8 beta (C8B) (NM_000066) Human Recombinant Protein
TP319942M 100 µg

Complement factor 8 beta (C8B) (NM_000066) Human Recombinant Protein

Sign In for Pricing
View Details
Anti-Frizzled homolog 1/FZD1 Antibody Picoband® (FITC Conjugate)
PB9594-FITC 100 µg/Vial

Anti-Frizzled homolog 1/FZD1 Antibody Picoband® (FITC Conjugate)

Sign In for Pricing
View Details
Recombinant Human Hsp27
11110P 10ug

Recombinant Human Hsp27

Sign In for Pricing
View Details
Septin 11 CRISPR/Cas9 KO Plasmid (h)
sc-407969 20 µg

Septin 11 CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details