Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BTBD7 Peptide - N-terminal region

BTBD7 Peptide - N-terminal region

Product Specifications

UniProt

G3V3T2

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BTBD7 Rabbit Polyclonal Antibody (orb586663) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SPRVGGNSQAQQTFIGTSSYSQQGYGCESKLYSLDHGHEKPQDKKKRTSG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZBTB25 (Zinc Finger and BTB Domain-containing Protein 25, Zinc Finger Protein 46, ZNF46, Zinc Finger Protein KUP, C14orf51) (PE)
MBS6161119-01 0.1 mL

ZBTB25 (Zinc Finger and BTB Domain-containing Protein 25, Zinc Finger Protein 46, ZNF46, Zinc Finger Protein KUP, C14orf51) (PE)

Sign In for Pricing
View Details
ZBTB25 (Zinc Finger and BTB Domain-containing Protein 25, Zinc Finger Protein 46, ZNF46, Zinc Finger Protein KUP, C14orf51) (PE)
MBS6161119-02 5x 0.1 mL

ZBTB25 (Zinc Finger and BTB Domain-containing Protein 25, Zinc Finger Protein 46, ZNF46, Zinc Finger Protein KUP, C14orf51) (PE)

Sign In for Pricing
View Details
Colloidal Gold Conjugated Monoclonal Antibody to Human IgE,  15nm
GM-19-15 1 mL

Colloidal Gold Conjugated Monoclonal Antibody to Human IgE, 15nm

Sign In for Pricing
View Details
PGM5P1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
36515061 1.0 µg DNA

PGM5P1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Anti-Procainamide Antibody
16709 100ug

Anti-Procainamide Antibody

Sign In for Pricing
View Details
Rabbit anti-ADAM33 Antibody
DL96662A-01 50 µL

Rabbit anti-ADAM33 Antibody

Sign In for Pricing
View Details