Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CAPRIN2 Peptide - N-terminal region

CAPRIN2 Peptide - N-terminal region

Product Specifications

UniProt

Q6IMN6

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CAPRIN2 Rabbit Polyclonal Antibody (orb586667) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FGYQSPSGHSEEEREGNMKSAKPQVNHSQHGESQRALSPLQSTLSSAASP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cnot1 3'UTR Lenti-reporter-Luc Vector
16485084 1.0 µg

Cnot1 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Porcine Coiled-coil domain-containing protein 149 (CCDC149) ELISA Kit
MBS7245295-01 48 Well

Porcine Coiled-coil domain-containing protein 149 (CCDC149) ELISA Kit

Sign In for Pricing
View Details
Porcine Coiled-coil domain-containing protein 149 (CCDC149) ELISA Kit
MBS7245295-02 96 Well

Porcine Coiled-coil domain-containing protein 149 (CCDC149) ELISA Kit

Sign In for Pricing
View Details
Porcine Coiled-coil domain-containing protein 149 (CCDC149) ELISA Kit
MBS7245295-03 5x 96 Well

Porcine Coiled-coil domain-containing protein 149 (CCDC149) ELISA Kit

Sign In for Pricing
View Details
Porcine Coiled-coil domain-containing protein 149 (CCDC149) ELISA Kit
MBS7245295-04 10x 96 Well

Porcine Coiled-coil domain-containing protein 149 (CCDC149) ELISA Kit

Sign In for Pricing
View Details
PCMV-mCherry-FNTB-3xFLAG-Neo Plasmid
PVT76754 2 µg

PCMV-mCherry-FNTB-3xFLAG-Neo Plasmid

Sign In for Pricing
View Details