ALDH16A1 Peptide - N-terminal region
ALDH16A1 Peptide - N-terminal region
Product Specifications
UniProt
Q8IZ83
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ALDH16A1 Rabbit Polyclonal Antibody (orb586762) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: YGPVPESHACALAWLDTQDRCLGHYVNGKWLKPEHRNSVPCQDPITGENL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC881231-100 1x 100 µL
Eosinophil Peroxidase (AHE-1), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400096-500 1x 500 µL
Histone H1 (AE-4), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400994-100 1x 100 µL
TNF alpha (J2D10), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680178-500 1x 500 µL
CD50 (ICAM-3) (186-2G9), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400031-100 1x 100 µL
Mucin 5AC (MUC5AC) (45M1), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 