Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

JAML Peptide - C-terminal region

JAML Peptide - C-terminal region

Product Specifications

Product Name Alternative

AMICA, Gm638, AMICA1, CREA7-1, CREA7-4

UniProt

Q86YT9

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with JAML Rabbit Polyclonal Antibody (orb586765) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001091996.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VCATILLLPVLILIVKKTCGNKSSVNSTVLVKNTKKTNPEMKEKPCHFER

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Linsitinib-d3
sc-495659 10 mg

Linsitinib-d3

Sign In for Pricing
View Details
SLC4A2
CSB-CL021667HU1 10 μg Plasmid + 200 μL Glycerol

SLC4A2

Sign In for Pricing
View Details
Jakmip2 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K3295003 1.0 µg DNA

Jakmip2 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Recombinant Human PRCP Protein, His (Fc)-Avi-tagged
PRCP-3903H 50 µg

Recombinant Human PRCP Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
PIM2 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
36697066 1.0 µg DNA

PIM2 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
GGCX Protein Vector (Rat) (pPM-C-HA)
PV270060 500 ng

GGCX Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details