Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

JAML Peptide - C-terminal region

JAML Peptide - C-terminal region

Product Specifications

Product Name Alternative

AMICA, Gm638, AMICA1, CREA7-1, CREA7-4

UniProt

Q86YT9

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with JAML Rabbit Polyclonal Antibody (orb586765) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001091996.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VCATILLLPVLILIVKKTCGNKSSVNSTVLVKNTKKTNPEMKEKPCHFER

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

USP6
529553-01 100 µL

USP6

Sign In for Pricing
View Details
USP6
529553-02 200 µL

USP6

Sign In for Pricing
View Details
CD28 (phospho Tyr218) rabbit pAb Antibody
orb770907-01 50 μL

CD28 (phospho Tyr218) rabbit pAb Antibody

Sign In for Pricing
View Details
CD28 (phospho Tyr218) rabbit pAb Antibody
orb770907-02 100 µL

CD28 (phospho Tyr218) rabbit pAb Antibody

Sign In for Pricing
View Details
SPON2 (NM_012445) Human Over-expression Lysate
LH08821V 100 µg

SPON2 (NM_012445) Human Over-expression Lysate

Sign In for Pricing
View Details
Anti-Annexin VI Antibody (4J550)
TMAB-02598-01 50 μL

Anti-Annexin VI Antibody (4J550)

Sign In for Pricing
View Details