Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tex35 Peptide - middle region

Tex35 Peptide - middle region

Product Specifications

UniProt

Q5T0J7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Tex35 Rabbit Polyclonal Antibody (orb326659) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LINTQKNYKLPLRRAPKEQQELRLMGKTHREPQLRPKKMDGASGVNGAPC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cow Immunoglobulin G1 (IgG1) ELISA Kit
abx392333-01 96 Tests

Cow Immunoglobulin G1 (IgG1) ELISA Kit

Sign In for Pricing
View Details
Cow Immunoglobulin G1 (IgG1) ELISA Kit
abx392333-02 5x 96 Tests

Cow Immunoglobulin G1 (IgG1) ELISA Kit

Sign In for Pricing
View Details
Cow Immunoglobulin G1 (IgG1) ELISA Kit
abx392333-03 10x 96 Tests

Cow Immunoglobulin G1 (IgG1) ELISA Kit

Sign In for Pricing
View Details
HRES1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K0989307 1.0 µg DNA

HRES1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Mouse Polr2c qPCR Primer Pair
QM20394S 200 Tests

Mouse Polr2c qPCR Primer Pair

Sign In for Pricing
View Details
67kDa Laminin Receptor Rabbit mAb (AMR11675N)
AMR11675N-01 50 µL

67kDa Laminin Receptor Rabbit mAb (AMR11675N)

Sign In for Pricing
View Details