Tex35 Peptide - middle region
Tex35 Peptide - middle region
Product Specifications
UniProt
Q5T0J7
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Tex35 Rabbit Polyclonal Antibody (orb326659) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LINTQKNYKLPLRRAPKEQQELRLMGKTHREPQLRPKKMDGASGVNGAPC
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
LV699249 1.0 µg DNA
INPPL1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
Sign In for Pricing
View Details 
VAng-Ly2216-50gEcoli 50 µg (E. coli)
Recombinant Campylobacter Jejuni lpxB Protein (aa 1-364) (strain 81116 / NCTC 11828)
Sign In for Pricing
View Details 