Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCDC39 Peptide - N-terminal region

CCDC39 Peptide - N-terminal region

Product Specifications

UniProt

F8WBW2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CCDC39 Rabbit Polyclonal Antibody (orb586776) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QELSITQSLCKARERETESEEHFKAIAQRELGRVKDEIQRLENEMASILE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Synj1 Mouse Gene Knockout Kit (CRISPR)
KN517063 1 Kit

Synj1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
DDX39A Antibody
KC-44288-01 50 μL

DDX39A Antibody

Sign In for Pricing
View Details
DDX39A Antibody
KC-44288-02 100 µL

DDX39A Antibody

Sign In for Pricing
View Details
DDX39A Antibody
KC-44288-03 1 mL

DDX39A Antibody

Sign In for Pricing
View Details
4-Acetoxyisophthalic Acid
TRC-A189650-1G 1 g

4-Acetoxyisophthalic Acid

Sign In for Pricing
View Details
HOXC6 (isoform 1) Goat Polyclonal Antibody
AP32958PU-N 100 µg

HOXC6 (isoform 1) Goat Polyclonal Antibody

Sign In for Pricing
View Details