CCDC39 Peptide - N-terminal region
CCDC39 Peptide - N-terminal region
Product Specifications
UniProt
F8WBW2
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CCDC39 Rabbit Polyclonal Antibody (orb586776) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: QELSITQSLCKARERETESEEHFKAIAQRELGRVKDEIQRLENEMASILE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![CD166 (ALCAM) Mouse Monoclonal Antibody [Clone ID: 3F8B12]](https://cdn.genprice.uk/products/937/68dd189a061270361e8fbd06/imageurl/am06237su-n.webp)
AM06237SU-N 100 µL
CD166 (ALCAM) Mouse Monoclonal Antibody [Clone ID: 3F8B12]
Sign In for Pricing
View Details 
BNC402027-500 1x 500 µL
CD45 / LCA (Leucocyte Marker) (PTPRC/1147 + PTPRC/1460), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
