Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ENTPD6 Peptide - C-terminal region

ENTPD6 Peptide - C-terminal region

Product Specifications

UniProt

H0Y473

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ENTPD6 Rabbit Polyclonal Antibody (orb586798) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ALRMFNRTYKLYSYSYLGLGLMSARLAILGGVEGQPAKDGKELVSPCLSP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BRCC3 Polyclonal Antibody, PE Conjugated
bs-6888R-PE 100 µL

BRCC3 Polyclonal Antibody, PE Conjugated

Sign In for Pricing
View Details
E2F2 Antibody
A60160-100UL 100 µL

E2F2 Antibody

Sign In for Pricing
View Details
PRDM10 Antibody - middle region : Biotin (ARP39405_P050-Biotin)
ARP39405_P050-Biotin 100 µL

PRDM10 Antibody - middle region : Biotin (ARP39405_P050-Biotin)

Sign In for Pricing
View Details
APC Anti-Mouse CD4 Antibody[RM4-5]
FCE3802-01 50 Tests

APC Anti-Mouse CD4 Antibody[RM4-5]

Sign In for Pricing
View Details
APC Anti-Mouse CD4 Antibody[RM4-5]
FCE3802-02 100 Tests

APC Anti-Mouse CD4 Antibody[RM4-5]

Sign In for Pricing
View Details
APC Anti-Mouse CD4 Antibody[RM4-5]
FCE3802-03 2x 100 Tests

APC Anti-Mouse CD4 Antibody[RM4-5]

Sign In for Pricing
View Details