Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ENTPD6 Peptide - C-terminal region

ENTPD6 Peptide - C-terminal region

Product Specifications

UniProt

H0Y473

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ENTPD6 Rabbit Polyclonal Antibody (orb586798) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ALRMFNRTYKLYSYSYLGLGLMSARLAILGGVEGQPAKDGKELVSPCLSP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Myosin Heavy Chain 11, Smooth Muscle (MYH11) ELISA Kit
EKN47201 96 Tests

Human Myosin Heavy Chain 11, Smooth Muscle (MYH11) ELISA Kit

Sign In for Pricing
View Details
CDC23 Rabbit Monoclonal Antibody [KD Validation]
E51K4258 40 µL

CDC23 Rabbit Monoclonal Antibody [KD Validation]

Sign In for Pricing
View Details
Anti-Human CD30/TNFRSF8 Antibody (SAA1390), APC
MBS1583932-01 50 Tests

Anti-Human CD30/TNFRSF8 Antibody (SAA1390), APC

Sign In for Pricing
View Details
Anti-Human CD30/TNFRSF8 Antibody (SAA1390), APC
MBS1583932-02 100 Tests

Anti-Human CD30/TNFRSF8 Antibody (SAA1390), APC

Sign In for Pricing
View Details
Anti-Human CD30/TNFRSF8 Antibody (SAA1390), APC
MBS1583932-03 5x 100 Tests

Anti-Human CD30/TNFRSF8 Antibody (SAA1390), APC

Sign In for Pricing
View Details
Sheep L selectin ELISA kit
GTR10373615 96 Well

Sheep L selectin ELISA kit

Sign In for Pricing
View Details