Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ENTPD6 Peptide - C-terminal region

ENTPD6 Peptide - C-terminal region

Product Specifications

UniProt

H0Y473

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ENTPD6 Rabbit Polyclonal Antibody (orb586798) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ALRMFNRTYKLYSYSYLGLGLMSARLAILGGVEGQPAKDGKELVSPCLSP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Triacetonamine hydrochloride
BUP18040-01 100 mg

Triacetonamine hydrochloride

Sign In for Pricing
View Details
Triacetonamine hydrochloride
BUP18040-02 500 mg

Triacetonamine hydrochloride

Sign In for Pricing
View Details
Triacetonamine hydrochloride
BUP18040-03 1 g

Triacetonamine hydrochloride

Sign In for Pricing
View Details
Olfr914 Lentiviral Activation Particles (m2)
sc-434895-LAC-2 200 µL

Olfr914 Lentiviral Activation Particles (m2)

Sign In for Pricing
View Details
Anti-Zebrafish CHD7 Antibody (Dylight488 Conjugate)
DZ01533-Dylight488 200 µL

Anti-Zebrafish CHD7 Antibody (Dylight488 Conjugate)

Sign In for Pricing
View Details
EGFR Recombinant Rabbit mAb, Cy5.5 conjugated
orb1585790 100 µL

EGFR Recombinant Rabbit mAb, Cy5.5 conjugated

Sign In for Pricing
View Details