Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ENTPD6 Peptide - C-terminal region

ENTPD6 Peptide - C-terminal region

Product Specifications

UniProt

H0Y473

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ENTPD6 Rabbit Polyclonal Antibody (orb586798) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ALRMFNRTYKLYSYSYLGLGLMSARLAILGGVEGQPAKDGKELVSPCLSP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Blimp-1 (3H2E8) Alexa Fluor® 488
sc-66015 AF488 200 µg/mL

Blimp-1 (3H2E8) Alexa Fluor® 488

Sign In for Pricing
View Details
Mouse Monoclonal SDHB Antibody (SDHB/2126) [Alexa Fluor 700]
NBP3-08809AF700 100 µL

Mouse Monoclonal SDHB Antibody (SDHB/2126) [Alexa Fluor 700]

Sign In for Pricing
View Details
Recombinant Caenorhabditis Elegans B0361.6 Protein (aa 1-378)
VAng-Ly3052-500gEcoli 500 µg (E. coli)

Recombinant Caenorhabditis Elegans B0361.6 Protein (aa 1-378)

Sign In for Pricing
View Details
Rabbit anti-HBP1 Antibody
MBS4512181-01 0.05 mL

Rabbit anti-HBP1 Antibody

Sign In for Pricing
View Details
Rabbit anti-HBP1 Antibody
MBS4512181-02 0.1 mL

Rabbit anti-HBP1 Antibody

Sign In for Pricing
View Details
Rabbit anti-HBP1 Antibody
MBS4512181-03 5x 0.1 mL

Rabbit anti-HBP1 Antibody

Sign In for Pricing
View Details