Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FRMPD2 Peptide - N-terminal region

FRMPD2 Peptide - N-terminal region

Product Specifications

UniProt

Q68DX3

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FRMPD2 Rabbit Polyclonal Antibody (orb586803) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LLQGQSEDEQPDASQMHVYSLGMTLYWSAGFHVPPHQPLQLCEPLHSILL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OKRC00104-96W - IL-10 ELISA Kit (Chicken)
OKRC00104-96W 96 Well

OKRC00104-96W - IL-10 ELISA Kit (Chicken)

Sign In for Pricing
View Details
Bovine carbonic anhydrase (CA) ELISA Kit
YP-W77814-01 48 Tests

Bovine carbonic anhydrase (CA) ELISA Kit

Sign In for Pricing
View Details
Bovine carbonic anhydrase (CA) ELISA Kit
YP-W77814-02 96 Tests

Bovine carbonic anhydrase (CA) ELISA Kit

Sign In for Pricing
View Details
Rabbit Cortisone ELISA kit
GTR10383658 96 Well

Rabbit Cortisone ELISA kit

Sign In for Pricing
View Details
Art4 (NM_026639) Mouse Tagged ORF Clone Lentiviral Particle
MR221420L4V 200 µL

Art4 (NM_026639) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
TENC1 (TNS2) (NM_170754) Human Tagged ORF Clone Lentiviral Particle
RC218847L3V 200 µL

TENC1 (TNS2) (NM_170754) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details