Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FRMPD2 Peptide - N-terminal region

FRMPD2 Peptide - N-terminal region

Product Specifications

UniProt

Q68DX3

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FRMPD2 Rabbit Polyclonal Antibody (orb586803) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LLQGQSEDEQPDASQMHVYSLGMTLYWSAGFHVPPHQPLQLCEPLHSILL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat anti-Il6ra (mouse) Antibody
MBS423244-01 0.1 mg

Goat anti-Il6ra (mouse) Antibody

Sign In for Pricing
View Details
Goat anti-Il6ra (mouse) Antibody
MBS423244-02 5x 0.1 mg

Goat anti-Il6ra (mouse) Antibody

Sign In for Pricing
View Details
Cytochrome P450 Reductase Antibody: ATTO 390
MBS806405-01 0.1 mg

Cytochrome P450 Reductase Antibody: ATTO 390

Sign In for Pricing
View Details
Cytochrome P450 Reductase Antibody: ATTO 390
MBS806405-02 5x 0.1 mg

Cytochrome P450 Reductase Antibody: ATTO 390

Sign In for Pricing
View Details
Strat Antibody
orb806411 2 mg

Strat Antibody

Sign In for Pricing
View Details
PPP2R3 Rabbit Polyclonal Antibody (PE)
orb484561 100 µL

PPP2R3 Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details