Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CES4A Peptide - C-terminal region

CES4A Peptide - C-terminal region

Product Specifications

UniProt

F5H5S4

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CES4A Rabbit Polyclonal Antibody (orb586960) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KYWANFARTGNPNDGNLPCWPRYNKDEKYLQLDFTTRVGMKLKEKKMAFW

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Benzoic Acid-d5 Ethyl Ester
TRC-B203907-10MG 10 mg

Benzoic Acid-d5 Ethyl Ester

Sign In for Pricing
View Details
Desfluoro-Abemaciclib-D5
TRC-D115462-100MG 100 mg

Desfluoro-Abemaciclib-D5

Sign In for Pricing
View Details
NANP Polyclonal Antibody
E-AB-53114-01 20 µL

NANP Polyclonal Antibody

Sign In for Pricing
View Details
NANP Polyclonal Antibody
E-AB-53114-02 60 µL

NANP Polyclonal Antibody

Sign In for Pricing
View Details
NANP Polyclonal Antibody
E-AB-53114-03 120 µL

NANP Polyclonal Antibody

Sign In for Pricing
View Details
NANP Polyclonal Antibody
E-AB-53114-04 200 µL

NANP Polyclonal Antibody

Sign In for Pricing
View Details