Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CES4A Peptide - C-terminal region

CES4A Peptide - C-terminal region

Product Specifications

UniProt

F5H5S4

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CES4A Rabbit Polyclonal Antibody (orb586960) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KYWANFARTGNPNDGNLPCWPRYNKDEKYLQLDFTTRVGMKLKEKKMAFW

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TJAP1 Antibody
OC-476-01 50 μL

TJAP1 Antibody

Sign In for Pricing
View Details
TJAP1 Antibody
OC-476-02 100 µL

TJAP1 Antibody

Sign In for Pricing
View Details
TJAP1 Antibody
OC-476-03 1 mL

TJAP1 Antibody

Sign In for Pricing
View Details
POU4F3 (NM_002700) Human Over-expression Lysate
LY400949 100 µg

POU4F3 (NM_002700) Human Over-expression Lysate

Sign In for Pricing
View Details
KDM1A (NM_015013) Human Over-expression Lysate
LC402400 20 µg

KDM1A (NM_015013) Human Over-expression Lysate

Sign In for Pricing
View Details
NOC3L Rabbit Polyclonal Antibody
TA392847 100 µL

NOC3L Rabbit Polyclonal Antibody

Sign In for Pricing
View Details